Abnova a4gnt polyclonal antibody

Product Description:Rabbit polyclonal antibody raised against recombinant A4GNT.

Immunogen:Recombinant protein corresponding to amino acids of human A4GNT.

Sequence:NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG

Host:Rabbit

Reactivity:Human

Form:Liquid

Purification:Antigen affinity purification

Isotype:IgG

Recommend Usage:Immunohistochemistry (1:50-1:200)

The optimal working dilution should be determined by the end user.

Storage Buffer:In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)

Storage Instruction:Store at 4°C. For long term storage store at -20°C.

Aliquot to avoid repeated freezing and thawing.

Note:This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

AI Meijie Abnova A4GNT Polyclonal antibody ： For restructuring  A4GNT  Rabbit polyclonal antibody produced .

Immunogen ： Corresponding to people  A4GNT  A recombinant protein of amino acids .

host ： The rabbit

Reactivity ： human beings

form ： Liquid

purification ： Antigen affinity purification

Allotype ：IgG

Recommended use ： Immunohistochemistry  (1:50-1:200)

Storage buffer ： stay  PBS  in ,pH 7.2（40%  glycerol ,0.02%  Sodium azide ）

Storage instructions ： Store in  4°C. stay -20°C  Under long-term storage .

Repack to avoid repeated freezing and thawing .

 

AI Meijie Abnova A4GNT Polyclonal antibody application ：

Immunohistochemistry （ Formalin /PFA  Fixed paraffin embedded sections ）

use  A4GNT  Polyclonal antibody （ Article No  PAB20405） Immunohistochemical staining of the human stomach showed , stay  1:50-1:200  At dilution , The cytoplasm of glandular cells was strongly positive .

AI Meijie Abnova A4GNT Research on polyclonal antibody ：

5-PAB21985

6-AADACL1 Polyclonal antibody ： For restructuring  AADACL1  Rabbit polyclonal antibody produced .

7-PAB28608

8-AADAC Polyclonal antibody ： For restructuring  AADAC  Rabbit polyclonal antibody produced .

9-H00008086-M02

10-AAAS  Monoclonal antibodies  (M02), clone  5A1： For Partial Restructuring  AAAS  Produced mouse monoclonal antibodies .

11-PAB28545

12-A2M Polyclonal antibody ： For restructuring  A2M  Rabbit polyclonal antibody produced .

13-MAB10476

14-A1BG  Monoclonal antibodies , clone  4B5： For Partial Restructuring  A1BG  Produced mouse monoclonal antibodies .