Abnova acid phosphatase (wheat germ) instructions

AI Meijie Abnova Acid phosphatase is an esterase , At best  pH  The value is less than  7.0  It has a wide range of activities . There are three isoenzymes ,EI、EII  and  EIII, Their molecular weights are similar  (55 kDa± 5 kDa). Their best  pH  Values, respectively  5.5、4.5  and  4.0. 

Abnova  acid phosphatase （ Wheat germ ） The basic parameters ：

Sequence ：VYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVS

host ： Wheat germ （ in vitro ）

Theoretical molecular weight （kDa）：34.43

Interspecific antigen sequence ： mouse  (94);  Rat  (92)

Method of preparation ： Wheat germ expression system in vitro

purification ： Glutathione agarose  4  Fast flow

Quality control testing ： Stained with Coomassie blue  12.5% SDS-PAGE.

Abnova Related research ：

P5314   Adenosine deaminase

P5205   Alcohol dehydrogenase （ yeast ）

P5247   Alkaline phosphatase （ chicken ）

P5268   Alkaline phosphatase （ E. coli ）

P5282   Alkaline phosphatase ,EIA  And molecular biology

P5269  β- Galactosidase （ E. coli ）

P5213   Butyrylcholinesterase （ Horse ）

P5208   Carbonic anhydrase

P5296   Carboxypeptidase  B（ The pig ）

P7075  Cas12a (Cpf1)  Nuclease